SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009803
Domain Number 1 Region: 36-137
Classification Level Classification E-value
Superfamily E set domains 0.000000000000427
Family Filamin repeat (rod domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009803
Sequence length 510
Comment (Tetraodon nigroviridis)
Sequence
LPRMAVSLELGLRLLLLFCLDGPRRGQPGAQADRVPSASNTLVWGPGLDANVVLPARFFY
IQAADSSGRNLTTSPGEKTFEVKIKSPGEHLTRIWLQVLDRKDGSFLVRYRMYATYSDLH
IHVLLKNEQVANSPFLLKGPVYHEGCDCPQPSGSVWEARMGCPDSFPQIDTDLSVFSSVD
PDRNAQEVPQRFGQRQSLCHYTVKDNKVYVKTFGEHVGFRIFMDSILLSLTRKVRLPDVE
FFVNLGDWPLEKRKPTDQIHPIFSWCGSNNTLDIVMPTYDLTESVLETMGRVSLDMMSVQ
ASTGPPWPEKNATAFWRGRDSRQERLELVKLSRAHPDMVDAAFTNFFFFKHDESLYGPLV
KHVSFFDFFKYKYQINIDGTVAAYRLPYLLAGDSVVFKQDSGYYEHFYNELRPWEHYVPI
RADLGDLLEKIRWARSHDEEVKKIALAGQQFARNHLMGDKILCYYYKLFKQYAELQISEP
RVRHGMEQVEQPGDDLFPCFCHRKRPKDEL
Download sequence
Identical sequences H3CNH1
ENSTNIP00000009803 99883.ENSTNIP00000009803 ENSTNIP00000009803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]