SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009872 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009872
Domain Number 1 Region: 148-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.34e-105
Family Transglutaminase core 0.0000000977
Further Details:      
 
Domain Number 2 Region: 8-147
Classification Level Classification E-value
Superfamily E set domains 2.59e-26
Family Transglutaminase N-terminal domain 0.00085
Further Details:      
 
Domain Number 3 Region: 496-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.88e-17
Family Transglutaminase, two C-terminal domains 0.0055
Further Details:      
 
Domain Number 4 Region: 613-708
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000000523
Family Transglutaminase, two C-terminal domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009872
Sequence length 710
Comment (Tetraodon nigroviridis)
Sequence
LTYMCVFAELNIQHASLETSENLQRHKTEGFSSSKALVVRRGAPFRVSLQLEGRPFNPKC
DSLRVKLSLGTQTPSTFCYSFKPSSARWQAYFKPEGLDLHRPSIWIFSPASASVGSYGFQ
LCVFTLGKIRRCMMGQFVLLCNPWCPEDTVYIPFEDQREEYIQNNSGLLFMGTPLNLVSR
PWSFDQFVPGVLEACLSLLQVSPQHRKNQRMDYANRGNPVYLSRIVSAMINCEDDNGVLK
GNWSDDFKQGVHPSSWTGSGDILRMWAQSNYSPVRYGQCWVFAAVMCTVMRVLGIPCRVV
TNFNSAHDTNGNLVIEEYYSETGVKLNHSNDSIWNFHVWVECWMDRNDLGPEMKGWQVLD
PTPQERSGGVFCCGPAPVKAIKDRRVDLFYDIPFVYAEVNADVYAIVVSKGRVVGHSKDT
EKVGSFICTNSCWSSHTPEHHQRLQIHHKQKLQPRHLREAPWYRRTLRYGEVSLNSSINH
ASCSNLDQPEAGSSSGIAVFLTLDKAPVAGEPICFSVTVLNRHQVAKKLKVHLNAQAKEY
NHNPSDTFWETHGTMEVSPKQTRVIKQHILPAQYEDVVGDGLINLAVVLEDMATQERALA
SEEFNVTSSQLIIEVADENSVTLNSEQTAVVTFFNHFSHPVSGILTVAGPSLIQGRVYFR
LLALPPGGRAQKRINFIPRMVGTKMLHANLSLANINSTITGFKMIFVNKV
Download sequence
Identical sequences H3CNN9
ENSTNIP00000009872 99883.ENSTNIP00000009872 ENSTNIP00000009872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]