SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000009936 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000009936
Domain Number 1 Region: 107-302
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-61
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 309-418
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-37
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 736-842
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 418-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 574-684
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 6 Region: 866-959
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 7 Region: 685-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000518
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 530-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000009936
Sequence length 970
Comment (Tetraodon nigroviridis)
Sequence
AVFWGDIALDEEDLRMFQIDRTIDLTQRAHTHSLHRQGHTSGGLEEHEALKKRGSLYLLL
ERIRRFGLDFLPKNTTKVAASPKSQTGKLGKTGSVIKSRFTRAATSRAERIWPGGVIPYV
IGGNFTGTQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQA
ISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVN
SLGEPYDFDSIMHYARNTFSRRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLY
RCPACGETLQDSTGNFSSPGYPNGYPSYTHCVWRISVTPGEKIILNFTTMDLYKSSLCWY
DYIEVRDGYWRKAPLLGRFCGDKVPDVLISTDSRMWIEFRSSSNWVGKGFAAIYEAICGG
EITKDSGQIQSPNYPDDYRPSKECVWRIAVSEGYNVGLSFQAFEIERHDSCAYDYLEVRD
GPLETSPLIGRFCGYDKPEDVRSTSHTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNG
GCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTISTPGWPKEYPPNKNC
VWQVVAPAQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQ
YNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRHGFVLHE
NKHDCKEAAECEHKIHSPTGTLSSPNWPDKYPSRKECTWDITATPGHRVKITFNEFEIEQ
HQECAYDHLEAFDGDGDQAAILGRLCGSKIPEQLISTGNKMYLRFISDASVQRKGFQATH
STECGGRLKAEIRQKNLYSHSQFGDNNYPGHTECEWLLSAEQGYGIELSFITFEVEEEAD
CGYDYIELYNGYEPNSHRLGRFCGSGPREGIYSPGSVMLIRFHSDDTISKKGFHLRYQSA
KFQESLHTRK
Download sequence
Identical sequences H3CNV3
ENSTNIP00000009936 99883.ENSTNIP00000009936 ENSTNIP00000009936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]