SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010244
Domain Number 1 Region: 182-378
Classification Level Classification E-value
Superfamily E set domains 4.01e-61
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000201
Further Details:      
 
Domain Number 2 Region: 74-217
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010244
Sequence length 432
Comment (Tetraodon nigroviridis)
Sequence
MTSATPPSSQSSSPQKVCHSQTQTDVSRPLLGSQESNGGSGMGAGGPGALRRRRRVLSKD
GRSNVLIEHVSGRGALYLRDLWTTFLDMQWRYKFFLFSATFAGTWFVFGVLWYLVAMVHG
DLQEFNPPSNHTPCVMEVKTLTGAFLFSLESQTTIGYGFRCITEECPVAIVLLIFQLVIT
MVMEIFITGTFLAKVARPKKRGETVKFSQHAVVSDHEGLPCLMIRVANMRKSLLLGCQVT
GKLLQTSMTKEGETVRLDQRNVPFQVDTSSDSPFLIIPLTFYHVIDDSSPLRAWAAKGGG
WTDPELADFELLVIMSATVEPTSATCQVRTSYLPDEILWGYEFPPVVSLSPSGKYVADFA
FFDKVAKTKTPPLFKQTLSTGPKSQGPHRREEEGDSVDTEKRRLEESYRGEDRGRERRIR
DSSPLSVRISNV
Download sequence
Identical sequences H3CPR1
ENSTNIP00000010244 99883.ENSTNIP00000010244 ENSTNIP00000010244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]