SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010271
Domain Number 1 Region: 117-181
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000144
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010271
Sequence length 196
Comment (Tetraodon nigroviridis)
Sequence
MDPETPNQPLIRGNTAATEPANGGRSTRAYKVAGITLLACVLVVGQAMTAYFLLTQKGEI
KSLEEQSNKLKSEMTKGRSEAASSSQMRIPAIPIPGLFDISLDKDTEPEKKEGPANPQVT
DCQLKASGMKSSGVPGFSPVCDERGFYQAEQCFMGQCWCVNPLSGDVIPGSMRNGQASCS
TAAVAGSLSRAMAVPE
Download sequence
Identical sequences H3CPT8
99883.ENSTNIP00000010271 ENSTNIP00000010271 ENSTNIP00000010271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]