SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010318
Domain Number 1 Region: 21-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 2 Region: 77-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000010318
Domain Number - Region: 122-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010318
Sequence length 165
Comment (Tetraodon nigroviridis)
Sequence
SVLFCTASTVPSVLRRALADCECYGHSNRCSYIDYLNIVTCVSCKHNTRGQNCQHCRLGY
YRNTSAELDDESICIECNCNQMGSVHDRCNGTGFCQCREGATGAKCDDCVPGYHWKQGCH
LNVCDEEMLLCQNGGTCFQNQKCCPAEFKGVLCQTLALRGGQGLQ
Download sequence
Identical sequences H3CPY4
ENSTNIP00000010318 99883.ENSTNIP00000010318 ENSTNIP00000010318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]