SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010486
Domain Number 1 Region: 7-175
Classification Level Classification E-value
Superfamily E set domains 7.7e-78
Family Arrestin/Vps26-like 0.0000000948
Further Details:      
 
Domain Number 2 Region: 177-402
Classification Level Classification E-value
Superfamily E set domains 5.13e-65
Family Arrestin/Vps26-like 0.0000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010486
Sequence length 406
Comment (Tetraodon nigroviridis)
Sequence
MGDKAGTRVFKKSSPNCKVTVYLGKDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCA
FRYGREDLDVLGLSFRKDLYISTFQAFPPVPEERKPNSRLQERLLKKLGQHAHPFYFTIP
QNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPGP
QPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYAD
ICLFSTAQYKCPVAQLEADDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTNL
ASSTIVKDVTNKEVLGILVSYRVKVKLVVSRGGDVSVELPFILMHPKPVEPPASRPQSAV
PEMDPPIDTNLIEFDTNSVSQDDDFVFEDFARLRLKGVVDDKDEDC
Download sequence
Identical sequences H3CQF2
99883.ENSTNIP00000010486 ENSTNIP00000010486 ENSTNIP00000010486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]