SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010690
Domain Number 1 Region: 534-580
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000575
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 46-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 109-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 490-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010690
Sequence length 581
Comment (Tetraodon nigroviridis)
Sequence
MQTSLLHGFFCLLLLSGVVVATAGDEDLASVRQARSAGGQVTAQPVDCVLSEWSAWSRCD
TCQKKRYRYAKLEQPSQFGGQPCNFHGREEEACTVSSRYTCDNIPVCEGFLCATTGRCIP
RTLQCSGEDDCGDMSDEVGCRKVSKPCRSEGLSESANRLTANVPCFRINVLDSNLAGVVL
DNRYYAGSCLPHYIQDVRFRKPYNLEQYTLQTKGSYDFILHSYDSYSSYMDFTLKERMTQ
TVVSFGFAIPGVFEFGFNYNSAKYSKSVKKLRRVSGKSYSFVRAKAQLELAQYMLKSNDL
MLHPEFLHRLRALPLSYVYGEYRQIFQDYGTHYITEAALGGEFEYTIILNKERLEQSDYT
LEDYKKCAQAGLKVGANIYGVYVSAGVHGGSCNGLLNEMGENTARGSMVEDFVSVVRGGT
SESITALLSKKLPTPELMRLWGEGVQFNPDFIRRTTQPLYELVTSRDFSQASTLKRNLKR
ALSEYLAEASACRCAPCLNNGVAVLRGTRCDCICPVGYTGDGCEITTRRGDVAIDGSWSC
WGPWSSCSGGTVTRSRQCNNPAPSFGGMACRGLQQESTSCS
Download sequence
Identical sequences H3CR06
ENSTNIP00000000750 ENSTNIP00000010690 99883.ENSTNIP00000010690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]