SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010807
Domain Number 1 Region: 270-395
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.42e-24
Family PWWP domain 0.0068
Further Details:      
 
Domain Number 2 Region: 134-264
Classification Level Classification E-value
Superfamily Bromodomain 8.11e-16
Family Bromodomain 0.0031
Further Details:      
 
Domain Number 3 Region: 86-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000074
Family PHD domain 0.022
Further Details:      
 
Domain Number 4 Region: 558-601
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000105
Family MYND zinc finger 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010807
Sequence length 603
Comment (Tetraodon nigroviridis)
Sequence
MSRVVKKRQADPKAVQYVWAAIEVIRNQKQIANMDRISKYLSRVFGMHPKETARQLSLAV
KDGLVVETLTVGCKGSKAGIEQEGYWLPGDEMEWEAESHDWYCFECHLAGDVLPCDNCFR
VYHLKCLSEEFKPRDGGSHWQCVVCRGSKKKNLNKQEMAKYLRFIVQRMRERAVDLNKKG
KDTKHPMYRRLIHTALDVSNIQENLSEGKYKSFDEFKADAQLILHNTAILYGVHSDQAEI
ARLLYSDTCHELNELLLCKNCFYLSNARPDNWFCYPCVPSHDLVWAKMKGFGYWPAKVLQ
RDDNQVDVRFFGHQHQRAWIPSDNIQDIKVSVQQLQVKRSNGWKKACEELEVYQRFLREG
RVWKTKMDEAGTDEAESSISSTSNEQLRGGQEPKPKKSRRSQMVEPKRRDPEPEMEAVSS
SQEIPVCSAPQQPEKLSVSTQTKKASGSSPRLHRSTQTSSDGACQNMCHEKYTKVFNDVK
EMMKADNKRETERVVREALEKLRVEMEEEKRQAVSKAVASAQAEMERKCKQVKEKCKEEL
VEEVKKLVGQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHADHKRTCR
RKR
Download sequence
Identical sequences H3CRC3
ENSTNIP00000010807 99883.ENSTNIP00000010807 ENSTNIP00000010807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]