SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010903
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-78
Family Sec7 domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 260-379
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-33
Family Pleckstrin-homology domain (PH domain) 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010903
Sequence length 402
Comment (Tetraodon nigroviridis)
Sequence
MDDLDYIPVDLSPEERSELEDIRRRKGVLLQEIQRLREELREAILEVEGLEASTEGSKTL
QKSRHVAMGRKKFNMDPKKGIVFLVENELLRHTPEDIAQFLYKGEGLNKTAIGDYLGERD
DFNIKVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVF
QSTDTCYVLSFAIIMLNTSLHNPNVRDKPGVDRFISMNRGINEGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGSGGRVKTWKRRWFILTDNCLYYFEYTTDK
EPRGIIPLENLSIREVEDPRKPNCFELYIPNNRGQLIKACKTEADGRVVEGNHMVYRISA
PTPEEKDEWIHSIKSAVSVDPFYEMLAARKKRISLKKKEEQP
Download sequence
Identical sequences H3CRL9
99883.ENSTNIP00000010903 ENSTNIP00000010903 ENSTNIP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]