SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000010979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000010979
Domain Number 1 Region: 41-153
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-27
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 160-253
Classification Level Classification E-value
Superfamily LCCL domain 3.27e-24
Family LCCL domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000010979
Sequence length 397
Comment (Tetraodon nigroviridis)
Sequence
RPPGLLSGSGSLAHQSGRVLLSLTRPATEAARARTMVSGNGCGHTVLGAESGTLASQNYP
GTYPSNVWCRWKLRVSEGRTLRLLFGDFDVEDSPGCANGSLRITEKNGEPGLGPVCGTLD
ASQKNVTLKSNEVTISFRSGRHRSGRGFLLSYATDQYPGLISCLRRGSHFSSQHVSVYCP
AGCRNVTEDVWGSWEQGYRDTSVLCKSAVHAGVISDGQGGHVAVTRGRSLTLYESAFANG
ILSKMGSLSDKKLLLSRAGVITTGSAQFYIESYIVYFSKNLHLCWMWIKQRPTPLPRPQR
DRCWWRRVKAKSLTCPQSEFISYPLERNVHDALPSPPLNNYAEPAVGQKVGSTFRPSSDE
GYTTPFAFNHYDSPGNLPEYAEPLPPEPEYATPFSEQ
Download sequence
Identical sequences H3CRU5
99883.ENSTNIP00000010979 ENSTNIP00000010979 ENSTNIP00000010979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]