SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011193
Domain Number 1 Region: 194-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-26
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 530-640
Classification Level Classification E-value
Superfamily POZ domain 5.76e-21
Family BTB/POZ domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011193
Sequence length 723
Comment (Tetraodon nigroviridis)
Sequence
GVLSLPEALIRAGKSGEGNAYSQSDLRCVEQCLLATTVGSISELSDLVSRAMHYLQPLYT
KTHNNGTPMHQKCAVIHWQPEAIYTLCYFMHCPQMEWENPNVEPSTVTLQTERPFMVLPP
LMEWVRVAVVHTEHRRSFSVDSDDVRQAARLLLPGVDCEPRQLRTDDCVCASRRLDAAST
EAKFLQDLGFRMLSCGRTDLVKQAVNLLGPDGINSMSEQGMTPLMYACVRGDEAMVQMLL
DAGADINSEVPNSVHKHPSVFPETRQATPLTFAVLHGHVPVVQLLLDAKANVEGSLQDGM
ENYTETPLQLAAAAGNFELVSLLLERGADPMVGTMYRNGISTAPQGDMNSYSLAAAHGHR
NVFRRLLSHTEKGKGDVLSLEEILAEGSELEGRSLSQVDLIRTGKAKLKALREAMYHSSE
HGHVDITIDIRSLGVPWTLHTWLESLRTCFCQHRRPLIQGLLKEFSCIEEEEYTEELVTH
GLPLMFQILRASKNEVISQQLAAIFTQCYGPYPIPKLAEIKRKQTSRLDPHFLNNKDMSD
VTFLVEGKPFYAHKVLLFTASNRLSRFKTLLANRPCGENTCIEISNVKYHIFQLVMQYLY
YGGTETLHIRNTDIMELLSAAKFFQLEALQRHCEIICSKNINTETCVEIYNHTRFLEAPD
LASYIEGYFLKNMVILIELEPFKQLLYDAPPDSPGGDILQELEKTLAVRIQSIHLSSSKG
SIV
Download sequence
Identical sequences H3CSF9
99883.ENSTNIP00000011193 ENSTNIP00000011193 ENSTNIP00000011193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]