SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011277 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011277
Domain Number 1 Region: 84-286,339-426,462-487
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.52e-56
Family Diacylglycerol kinase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011277
Sequence length 500
Comment (Tetraodon nigroviridis)
Sequence
SVPVSELVAVREEEEENRDDGSWKKIKESEGQDCGQAFTVLYVERCQRHRWRCAEVTFAC
ADEALCQLWVSSIREQLATNTSRPEHLLVYINPCGGKRKAEHIYELKVAPLFARAGIRTH
VIVTEYANHARDHLKTEAELKKFDGVVCVGGDGMFSEIIHGLIWRTQIDNGIDLNCPEET
LLPCSLRIGIIPAGSTDCICFATVGTNDPVTSALHIIVGDSQPLDVCSVHHNSLFLRYSV
SLLGYGFYGDVLTDSERKRWMGPARYDLSGVKMFLTHHYYEGTVSYLPARDAIGTPRDAA
RCRSGCAVCKHNGEKLSETAERYKMDGALDSGDHESDSEWRTIRGKFLAINGASMSCACP
RSPKGLSPAAHLADGTTDLILVRKCSRFDFLRHLLRHTSKDDQFDLNFVEVHRVRRFRFT
PRHCQSDSDLELDLRESGKRQIFSQICRDHPACGCTPAYSSWNCDGEILTHTAIDVRVHC
QLIKLFARGIEEPTVFEDLA
Download sequence
Identical sequences H3CSP3
ENSTNIP00000011277 99883.ENSTNIP00000011277 ENSTNIP00000011277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]