SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011293
Domain Number 1 Region: 211-319
Classification Level Classification E-value
Superfamily PX domain 2.49e-25
Family PX domain 0.0014
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 350-555
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000488
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011293
Sequence length 559
Comment (Tetraodon nigroviridis)
Sequence
MAVKAKALYTFLSENKEEISIQENEELVIFDENSVDGWFQGENSRGERGLFPASYVEIIR
TRSDSNVTDCSISPAGSLGNESCYIPSANTSRYSQQSYYEEDDDDWDDWDDRSTVVDDGD
HNRSPGANGHAHPSPPSNNPSVHNRSKPPMERQDSISSSRKGSMVGRNLNRFSSFVRSGV
EAFVLGDVPMMVKIAEAYTIEMGPLGPWKESPQPFSCSIEDPTKQTKFKGIKTYISYRVT
PSHTAQPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMN
HMTSHPVLSQYEGFEHFLMCADDKQWKLGKRRAEKDEMVGAHFMLTLQIPTEHQDLQDVE
ERIDTFKSFAKKMDDSVMQLTHVASELVRKHLGGFRKEFQRLGNAFQSISQAFMLDPPYS
SEALNNAISHTGRTYENIGELFAEQPKYDLFQMLDKLSLYQGLLANFPDIIHLQKGAFAK
VKESQRMSDEGKMDQSEADGIRKRCRTVGFALQAEMSHFHLRREVDFKDMMQAYLREQIA
FYQRVVQQLERTLRMYECL
Download sequence
Identical sequences H3CSQ9
99883.ENSTNIP00000011293 ENSTNIP00000011293 ENSTNIP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]