SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011339
Domain Number 1 Region: 680-792
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00039
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-28
Family G proteins 0.00000656
Further Details:      
 
Domain Number 3 Region: 804-896
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 414-481,620-665
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000247
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011339
Sequence length 934
Comment (Tetraodon nigroviridis)
Sequence
MNYQSGVPVSAISQQSQPAMPTPGTVPVAVPVPVPQSIPSQFGSGSSASSGAGQFGSGTV
SGQAAQPGPPGSQFVLSNSAAIRAEIQRFESVHPNIYAIYDLIERIDDLALQNQIREHVI
SIEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEI
VVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLSSYRNAAEV
PMVLVGTQDAISAANPRVIDDSRAKKLPNDLKRCTYYECSTYGLNVERVFHDGEHGVVKV
VHLNRGWILPDKQSGSQPKRHGDAEARHLPSVGAGVASRAGVSAHDLLRSSEPRVGSGRV
SQTRSDTITHTQTPVSAHSDIPHKNTLYRSHEGNHGKASEQAKSVDSKTDSIGSGRAIPI
KQGILLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKIPGK
RPPRAVATVAPTASPKTNGLAKDRSGLQLGIGNTGASHSNSSTSLQTGGLVFGGSKDGMH
QRSFSVSSADQWNEAINTSTSSGAPNGTSDPAGSSAGSATSPKLEPPPSPHANRKKHRRK
KSTGITKPDGLSAGNEEQEDSFEFVIVSLTGQTWNFEASTYEEREFWVQAIESQIFASLQ
SCESIKNKSRLGSQSDAMAIQSIRNVRGNSFCVDCDAANPDWASLNLGALMCIECSGIHR
NLGTHLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALENYNKPGNDSTREEKERWI
RAKYDQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTA
LHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGSQECADILLQHGCPNDSSS
ATLTLAPNASLRNANPNINNNNAQCELNRSLSIM
Download sequence
Identical sequences H3CSV5
ENSTNIP00000011339 99883.ENSTNIP00000011339 ENSTNIP00000011337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]