SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011405
Domain Number 1 Region: 761-1076
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.22e-51
Family Ankyrin repeat 0.0000414
Further Details:      
 
Domain Number 2 Region: 226-413,480-522,612-677
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-48
Family Ankyrin repeat 0.00079
Further Details:      
 
Domain Number 3 Region: 541-752
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-32
Family Ankyrin repeat 0.00034
Further Details:      
 
Domain Number 4 Region: 50-163
Classification Level Classification E-value
Superfamily POZ domain 4e-20
Family BTB/POZ domain 0.0064
Further Details:      
 
Domain Number 5 Region: 1101-1160
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.3e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011405
Sequence length 1166
Comment (Tetraodon nigroviridis)
Sequence
LGTEEVAKLQKHLALLRQEYVKMQQKLADTERRCAMLAAQAPGQSSPNSTAASTFISRLL
DIVADLYQQEQYSDLKVKVAGKMLSAHKFVLAARSDAWSLANLASTTQLDLSDCKPEVAM
AMLRWVYTDELELSEDDAFLIDLMKLANRFQLQVLRERCEKGVMSSVNVRNCIRFYQTAE
ELNASTLMNYCGEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVF
LYLIEMDSQLPAKLNELDNNGDLALDLALSRKLESIATTLVNNKADVDMVDQSGWSLLHK
AIQRGDEFASVFLIRHSAQVNAATVGAVETPLHLVCSFSPKKHSAEVMAGMARIAEALLK
TGANPNMQNSKGRTPLHEAVASGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYITVS
TGASVNPFEDEAPVVNGTSFNENSFAAQLIQRGSNADAPDSATGHCLMQRAALAASEAAA
LFLATHGAKVNHVNKWGESPLHTACRCGLAGLTAELLQQGANPNLQTQKALPDDASGVAM
QTPLHMAIAHNHPDVVSVILEQKANALHATNNFQIIPDFSLKDSMDQTVLGLALWTGMHT
IAAQLLGSGASINDTMSNGQTLLHMAIHRQDSKSALFLLEHQADINMRTQEGETALQLAI
SNQLPLVVDAICTRGADMSVVNDSGDPPLWLALDSNLEDIASTLVRHGCDVTCWSTGPSG
CQQTLLHRAIDENNEVSACFLIRSGCDLNSCRRPGPNGEGDEEARDGQTPLHLASSWGLE
EVVQCLLEFGAHVNAQDAEGRAPIHVAISNQHSVIIQLLISHPDIRLNIRDRQGMTPFAC
AMTHKNNKAAEAIIKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRVQD
AAKLTPLHLAVQAGSEIIVRNLLLAGAKINELTKHRQTALHLAAQQDLATICSVLLENGV
DFAAEDENGNNALHLAVMQGRLNNVRALLTESNVDAEAFNLRGHSPMHVLGHYGKENAAA
IFELFLECMPEYPLDKPDNEGNTVLLLAYMKGNANLCRAIVRAGARLGVTNNQGINIFNY
QVATKQLLFRLLDMLSKEPPWCDGSNCYECAAKFGVTTRKHHCRHCGRLLCHKCSIKEIP
IIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences H3CT21
99883.ENSTNIP00000011405 ENSTNIP00000011405 ENSTNIP00000011405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]