SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011584
Domain Number 1 Region: 256-461
Classification Level Classification E-value
Superfamily vWA-like 1.7e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 2 Region: 114-225
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-21
Family Synaptotagmin-like (S variant) 0.07
Further Details:      
 
Domain Number 3 Region: 7-103
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-17
Family PLC-like (P variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011584
Sequence length 514
Comment (Tetraodon nigroviridis)
Sequence
TKVSLSVSCQNLLDKDHFSKSDPMCVLLMNTSGPHWCEVGRTEKIMNCLNPKFSKPFVVD
YYFEMVQKLRFELYDIDSENCSLQDADYLGELECTLGQICAEERTDSRVVEFEVAARKLD
KKDFFGKSDPFLEFYKRNETGWQLAHRTEVVKNNLNPTWRPFRIPLQSLCGGDVERPIKV
DCFDHNNSGSHDFIGCFETNLAQIQQTSATYAAEFECVNKKKKEKKKGYKNSGIIIVKKC
SVVKEYTFLDFIMGGCQINFTIAIDFTGSNGDPRLPNSLHYINPQGFNEYLAAIWAVGNV
IQDYDSDKMFPAFGFGAQIPPTMQVSHEFPINFNPSNPFCAGIEGVIQAYQQCLPQVKLY
GPTNFSPIINHVAQFGSQALHQQTASNYFVLLIITDGVITDMDETRSAIVNASRLPMSII
IVGVGGADFTAMEFLDGDDGILRSATGQAAMRDIVQFVPFRQFQNAPPELLAQSVLAEVP
GQVTGFFNAAKLTPPQGATAVSDPPASAPPGDLQ
Download sequence
Identical sequences Q4SKP8
ENSTNIP00000011584 99883.ENSTNIP00000011584 ENSTNIP00000011584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]