SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011764 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011764
Domain Number 1 Region: 449-560
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-35
Family Cap-Gly domain 0.0000512
Further Details:      
 
Domain Number 2 Region: 261-360
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.93e-32
Family Cap-Gly domain 0.0000469
Further Details:      
 
Domain Number 3 Region: 605-684
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.29e-26
Family Cap-Gly domain 0.0000431
Further Details:      
 
Domain Number 4 Region: 83-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.21e-16
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011764
Sequence length 697
Comment (Tetraodon nigroviridis)
Sequence
MTKEDVSEELEGDPVLGWLSSRQRPVIHQVASAPMPSDCEFSFFDPSDPQCRGVLLDPGT
TIPELFAVLRQWVPQVQRNIRAIGHEILKRGCGVNDRDGLTDMSLLHFCCKAGAQGIGDA
DAAADFARQLLALGADPNLRSRWTNMRALHYAAYFDVPQLIRVVMQASHPGEVDATCSDF
DFGTALHIAASNLCLSAVQCLLELGANPAFRNEKGLCPADVVPDPLDMPLEMAASAAVAK
ELRTLLRPLALALPAQRPPALSEKAKAQLASMGIRMGDCVVIAGQKVGTLQFCGSTEFSG
GLWAGVELDKPEGKNDGSVAGVQYFTCRMKYGIFAPLSKISKALERNKASTKASTPPRPP
RHIDSTRLRPKFNTGEVLGNLQSTAEAPLSKVLEPQDARKSMLLRSFSLPLSLKLCTDTS
DLSQRSFPQNSFSSIPFSCSGFSHSLSSSSSSLDKQSASPPASSSVCRGPEVRLGERVLV
AGQRTGVVKFCGKTNFAPGIWLGIKLDKPSGKNDGSVGGVRYFSCPPKHGVFAPPSRVQR
IHGSVDCLSELSSSRLAHSFSGEVRIRRSSSTSSAIASQKRTARSRPVTRSRSNPQSQRW
SPLGGGGASDGQVRLHVGMQVLLSSANEMASIRYLGTADFAPGIWLGLELRSPKGKNDGS
VGGRRYFSCRAGHGVLVRPSRVTYRGINGSRLLNDGQ
Download sequence
Identical sequences H3CU30
ENSTNIP00000011764 ENSTNIP00000011764 99883.ENSTNIP00000011764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]