SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000011852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000011852
Domain Number 1 Region: 10-173
Classification Level Classification E-value
Superfamily RUN domain-like 5.36e-47
Family RUN domain 0.000000261
Further Details:      
 
Domain Number 2 Region: 535-601
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000011852
Domain Number - Region: 198-261
Classification Level Classification E-value
Superfamily Prefoldin 0.000628
Family Prefoldin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000011852
Sequence length 605
Comment (Tetraodon nigroviridis)
Sequence
VPSKDPMSIERSNLLSMMKLSIKVLIQSSLSLGRTLDSEYPPLLQFFIVLEHCLKHGLKT
RKSFIGQNKSIWGPLELVEKLCPESANIATSARDLPGIRTGLGRGRAWLHLALMQKKVAD
YMKALLDRKDLLSDFYEPGALMMEEEGVVMGGLLVGLNVIDANLCIKGEDLDSQVGVIDF
SLYLKDPASSEPQRDDSKMTAILDQKHYIEELNRHLSGTVTDLQAKMDSLEKTNSKLVEE
LTAATDRINSLREEQEKLRQENDSILQSSQKKEEVTDDDSQVELETYKQTRQGDEMYNVV
WKQYKEEKHIRQDLERELELQVGLKQEMEVAMKLLEKDTHEKQDTLAALRLQLDQVKTLN
LQMFKKAQDSEQEAERKEAKAVQLEQRMNDMEKVIVELEQRLQNSERERKQSDQSDRDMK
LELEGKVDALQRQLTDLDALRLGLENSLRVEREQRQSLQKALQREQDNSVELRTQLQQLQ
GLHEELRSLKEEKQQLQQKCELQEQTLQEMGLHLSQSKLKMEDFKEVNKALKGHAWLKDD
EATHCKQCQKEFSIARRKHHCRNCGDIYCSGCSSNELALPSYPRPVRVCDMCHALLLQRS
SFGSS
Download sequence
Identical sequences H3CUB8
ENSTNIP00000011852 99883.ENSTNIP00000011852 ENSTNIP00000011852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]