SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000012220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000012220
Domain Number 1 Region: 142-314
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-60
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000504
Further Details:      
 
Domain Number 2 Region: 314-371
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000502
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000012220
Sequence length 371
Comment (Tetraodon nigroviridis)
Sequence
QPHPQVTPSKRRTVLNISPPPQDLLDDSKMSCQDETSWDSEQSNSIWMEDSRSNFSIMSI
SSYNDNTEVPRKSRKRTPRQRPGPKSAPAEEASMDVFDADSAKGPHFVLSQLGPDSKTGA
KGSSSSDDPRTNKQKGGTLVMQYPQKSEGKELKILVQPETQHRARYLTEGSRGSVKDHSQ
QGFPTVKLEGVHEPVVLQVFVANDAGRVKPHGFYQACRVTGRNTTACKEVDIDGTTVIEV
SLDPSTNMTLAVDCVGILKLRNADVEARIGVAGSKKKSTRARLVFRVNIPRSDGSLLTLQ
TPSSPILCTQPAGIPEILKKSLHSCSVRGGEEVFIIGKNFLKDTKVIFQENVADEKSWKA
EAEIDMELFHQ
Download sequence
Identical sequences H3CVD6
ENSTNIP00000012220 99883.ENSTNIP00000012220 ENSTNIP00000012220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]