SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000012396 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000012396
Domain Number 1 Region: 52-520
Classification Level Classification E-value
Superfamily Sema domain 7.06e-150
Family Sema domain 0.0000000841
Further Details:      
 
Domain Number 2 Region: 516-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000209
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000012396
Sequence length 1104
Comment (Tetraodon nigroviridis)
Sequence
QRAALLLSELLLLLTASCTLLAVSFPEDSVPLDVVDAHFSRRYPVFRGRPSANESQHRLD
FQLMTKIQDTLFIAGRDQVYLVSLRESYRNEIIPYRKLTWRSGQADRDMCAVKGKHRDEC
HNFIKVLVPRNDDLVFICGTNGFNPMCRYYRLDNLEFDGEEISGLARCPFDSKQTNVALF
AEGKLYSATVADFQASDSVIYRSMGDGSALRTIKYDSKWLKEPHFLHAAEYGNYVYFFYR
EIAVEQSSLGKVVYSRVARICKNDVGGSQRVLEKHWTSFVKARLNCSVPGESFFYFDVLQ
SITDIININGVPSVVGVFTTQMNSIPGSAVCAFSMADIEKVFWGRFKEQKTQDSVWTPFP
EEKLPKPRPGSCAGHSPAASFKSSIEFPDDTLQFIKSHPLMDTAVPSLGDEPWFTKTRVR
YRLTALAVDNEAGPHKNYTVVFIGAESGVVLKVLAKTPSVSLDDSLLLEEIDVFNRAKCL
SNREDDKRVLSLHVDKEAHSLYVAFSSCVIRIPLSRCERHSSCHKSCIALRDPYCGWPHS
ACERIQPGVSAEYEQDVESGNTTHLGDCHAFLGSTSAPDYKSFGDPTSDMEFSSTPVTVQ
PNGPIHPPVLIPTQSPSSGPDPDHYGSGFVLQDDPATSNTLNSIPGGQEGVWDIQAGETN
QMVHMNILITCVFAAFLMGALLAGLIVFCYRDSVLRKPRHVHKDTESAPSCSDSTGSFVK
LNGLFDSPVKEYQTNIDTPKLFTNLLTNSKDLNTPNSDTKTMILRDSCQPPELAALPTPE
STPVLQQKGLQPITNQWERAQGKVSGPRKESNSSAKSPQFLPAPALLNPKSHQGHIALGH
SHIPSAVVLPNATHELSNMDGGSDTLPHSSEKRLKNPDSKGSRKDPKRSVDARNTLNDLL
KHLNDSVANPKAILQEEPGPRPRQHLTLEPMDELTEIPPVVPSREASLYSPSSSLPRHSP
TKRVDVPLPTTPTTPTGSLSMGGTLERQRGGYQLHRSASHRHSLSTSQNGVTMGVSVSRQ
HSMNRGGCMPPTPPSRIDSHSGVMGPGMHSPHSSISRQNSYNGHCSLPRTGLKRTPSLKP
DVPPKPNGFSPQTSQMRVVNKYNY
Download sequence
Identical sequences H3CVW2
ENSTNIP00000012396 99883.ENSTNIP00000012396 ENSTNIP00000003980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]