SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000012745 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000012745
Domain Number 1 Region: 36-100
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000541
Family Ovomucoid domain III-like 0.0085
Further Details:      
 
Domain Number 2 Region: 144-226
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000677
Family Calbindin D9K 0.052
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000012745
Domain Number - Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.00837
Family VWC domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000012745
Sequence length 268
Comment (Tetraodon nigroviridis)
Sequence
PSGLCEAHTLLISVHCCPFIQEPCAFFQEESVCAKTVCGAGRECVPNDRGEPVCHCLQRC
DEREHWVCGSNGKSYRNHCELHREACLTQTKIRADQRGHCQGKRKPTKRDVSPIVCFLSD
RDWLRERVIQWIREEVEADHLASSASERLHTYFKMYDNGDSELDSKEFLSFLKHNETALN
LTYSKSLETNSLLRSLCVDALIELSDENADWKLSLNEFVNCLTPTYHPYERKCALEDEAF
EDGAETQMECNKCVCACGNWVCTALACN
Download sequence
Identical sequences H3CWW1
99883.ENSTNIP00000012745 ENSTNIP00000012745 ENSTNIP00000012745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]