SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000013254 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000013254
Domain Number 1 Region: 208-456
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.2e-45
Family ATP-dependent DNA ligase catalytic domain 0.00042
Further Details:      
 
Domain Number 2 Region: 463-607
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-29
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00044
Further Details:      
 
Domain Number 3 Region: 627-749
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.038
Further Details:      
 
Domain Number 4 Region: 15-257
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0000000000000811
Family ATP-dependent DNA ligase DNA-binding domain 0.0096
Further Details:      
 
Domain Number 5 Region: 833-898
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000641
Family BRCT domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000013254
Sequence length 898
Comment (Tetraodon nigroviridis)
Sequence
MEGPSRSDAAAQLSVAAQVPFLHLCTTLEKIQKAKARPDKSKILGDFIESWRNFHTALHK
NSKTTDSFYPAMRLLVPQFERERMAYGIKESMLAKLYIDVLGLPKNGPEANKLLNYRAPT
TSQGEAGDFASVAYFVLKKRCTSQGSLRVKEVNDFLDSVAINNANKKKDLVKKSLLHLIT
HSSALEQKWLIRMILKDMKLGVSKETVLQVFHPDSPDLYNVNTDLNKVCQQLHDPSVSLS
DVSIELFSAFKPMLAAVANIRSVEKQMGNSLFYIQTKLDGERIQLHKDGDVYKYFSRNAF
EYTQQFGGSPLQGSLTPYIHNVFQSNVVNCILDGEMMAYNPTTETLTQKGSKFDIKKLMD
DSELQTCFCVFDVLLVNDRKLGKEPLKKRYEALQTVFTPVKGRIHLVSKSDARSTQEVVK
ALNEAIDSREEGIMVKDPLSIYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGGRRG
GMMSHFLCAVAEAPKPGEKPSVFHTLCRIGSGYTMKELYDLGLKLAKHWKVFRKSDPPAS
ILCGTEKPEVYIEPRNSVIIQVKAAEIVSSDMYKTSCTLRFPRIERIREDKEWHECMTLA
QLEQFRGKASGKLASRHLLMDDDDPQKKKRRVPFKPKKAVGLLEHFKAQDLSGVRKETDM
FEDVEFCILNGTEDHSKSELEKGVARCGGIAVQNPGRDTYCVVAGVENMRVKNLILSDQH
DVVRAAWLLECLEQKEVVPWQPRHMIHMSPSTREHFAKEYDVYGDSYFVDSDEGQLREVF
GRSAWQVEQRCGWDDLPTSLFRPFRVYADAYAVIGDPRSAIPASRLSIRALELRFHGGTV
AQALEEGVSHVLVEEETRVADLRAARRSFRKKFKIVRDSWVTESIKAGHLMDDNDYLV
Download sequence
Identical sequences H3CYB9
ENSTNIP00000013254 ENSTNIP00000013254 99883.ENSTNIP00000013254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]