SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000013561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000013561
Domain Number 1 Region: 198-244
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000018
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 2 Region: 102-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000749
Family Ovomucoid domain III-like 0.001
Further Details:      
 
Domain Number 3 Region: 36-77
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000177
Family TB module/8-cys domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000013561
Sequence length 261
Comment (Tetraodon nigroviridis)
Sequence
RRRFERGVWNRLTGTMSFSVCVLAGFSLGCLMIPPAGMCWLQSQDQRCDMVLMRGVTREE
CCAGGRLDTAWSNTSMPMNEVSLLGFLGIVSCKPCKDTCEGVKCSSGKVCKMKMGRPQCV
CSPDCSHISRKHAVCGSDGKSYKDECTLLMARCMGHPDLEVMYQGDCKKSCSNVVCPGTH
TCVTDQTNSAHCVMCRTAPCPIPMLSEQAICGNDNVTYPSACHLRRATCFLGRSIGVRHY
GNCNNPPRRSHNQDRSEENGV
Download sequence
Identical sequences H3CZ76
99883.ENSTNIP00000013561 ENSTNIP00000013561 ENSTNIP00000013561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]