SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000013606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000013606
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-79
Family BAR domain 0.0000000176
Further Details:      
 
Domain Number 2 Region: 280-347
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000013606
Sequence length 352
Comment (Tetraodon nigroviridis)
Sequence
MSVAGLKKQFYKASQMVSEKVGGAEGTKLDDDFRDLERKVEVTSKAVVEVISKTSEYLQP
NPASRAKLSMLNTMSKIRGQVKNPGYPQAEGLLGECMSKYGRDLGEETNFGGALVDVGEA
MKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQGKIPD
EEVRQALEKFHESKEVAETSMYNLLETDIEQVSQLSSLVDSQLQYHRQAVQVLEELSDKL
RDRVNEAQSRPRREYTPKPKPIFDFGEDSHSNGGYSAPVALPPSRTTAALEQPSCKALYD
FEPENEGELGFHEGDIITLTNQIDENWYEGMLNGQSGFFPLNYVEVLIPLPH
Download sequence
Identical sequences H3CZC1
ENSTNIP00000013606 ENSTNIP00000013606 99883.ENSTNIP00000013606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]