SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000013614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000013614
Domain Number 1 Region: 554-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-68
Family Protein kinases, catalytic subunit 0.0000596
Further Details:      
 
Domain Number 2 Region: 163-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.45e-66
Family Ankyrin repeat 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000013614
Sequence length 942
Comment (Tetraodon nigroviridis)
Sequence
CAKPASDPEEYATKLRAATREKLKKFNSLRGRQVQPGEFWDVVVLTAVDGDQRGAYELQM
AEKVKRKELPRGPHYKIFSDPPGCKIGNGGSTLYALQQLSDAYGEALSSLRVLLIHADEW
KKKVGESYAVIIERLDDDLQLKDSELADLRLAFSSDEAFQKVNLSYRTEKGLSLLHLCCV
CEGSKAHIRTLILKGLRPSRLSRNGFTALHLAAYKDNAELVTALLHGGSDVQQVGYGALT
ALHVATLAGHHEATDILLQHGANVNVQDAVFFTPLHIASCYGHEQVAKLLLKFGADENVS
GEVGDRPLHLAAAKGFLSIVKLLVEEGSKAKVNAKDNEDHIPLHFSARFGHHEVVRFLLQ
GNFDVQPHAVNIYGDTPLHLACYNGKFESVKEIVQLSGTDGLSKENIFSETVLHRQCVHY
GKDLEMVKFLLSQNAMSINHQGRDGHTALHSACFHGHIRLVQFLLDNGADMNLVACDPSR
SSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPDDSPCNEYSQPGGASDGSYVSVPSPLGK
IKSMTKEKAEVLLLRVSLPSHFHLQMSELEFNEIIGSGSFGRVYRGKCRNKIVAIKRYRA
NTYCSKSDVDMFCREVSILCCLNHPCIIQFVGACLDDPSQFAIVTQYVSGGSLFSLLHEQ
KRLIDMQSKLIIAIDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAGLADFGESRFLQ
SVDEDNMTKQPGNLRWMAPEVFTQCTRYSVKADMFSYALCLWELFTGEIPFAHLKPAAAA
ADMAYHHIRPPIGYSIPKPISTLLMRGWYACPERREEFGEKEDVYNENECEKQLMAPASS
NSSGSLSPSSSSDCLLGRGGPGRSHVAALRSRFELEYALNTRAYAYWSQSERRRASGGLS
LEEVRKNMQRSPIDRNGYVSDPMSTMRCSSSFSSGGSFEDSN
Download sequence
Identical sequences H3CZC9
99883.ENSTNIP00000013614 ENSTNIP00000013614 ENSTNIP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]