SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000013843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000013843
Domain Number 1 Region: 13-101,136-173
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-29
Family Ankyrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000013843
Sequence length 178
Comment (Tetraodon nigroviridis)
Sequence
ATEKILGRARQLVDVKKEDGFSALHLAALNNHRDVAEILIKEGRCDINIRNNRNQTPLQL
AVTQGHTDLVQLLVAEGADVNMEDEDGDTAMHVALLRPQLARIINNTKGKGLEGDHPQLN
ASGLLGNTEISVGAAIACFLAQEGADINYANHKGKSPLDLVADGGTLQLLKSFSEKHR
Download sequence
Identical sequences H3D007
ENSTNIP00000013843 ENSTNIP00000013843 99883.ENSTNIP00000013843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]