SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014110
Domain Number 1 Region: 358-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-41
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 4.78e-18
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 139-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000259
Family B-box zinc-binding domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014110
Sequence length 514
Comment (Tetraodon nigroviridis)
Sequence
PAVMSSVDPSTDHFQCSICLDVFTAPVSTPCGHNFCLSCITSFWSLGTVRQCPLCKDTFH
GPVELQVNREFRDLLEIFRRTPLPPDDGAPLAGPGDVTCDLCCGRKSKAVKSCLVCLASY
CSVHLEPHGGVEALRWHKLVEPVRNLQERRCSKHSRAVESFCRDERCCLCPACLRDEHAQ
HNTVPIETEVEARRAQLEVMKKKVEERLSRRLAAVGRVRSSLTRSQQQVERTKEESLEVF
ASLVASLEATKLKLVRLLEEKQRRREQEAAEVLRRLQREVLHHREMGAQLEELCKAEDGF
ALLGDLPSLSPSSATEDRLPGGARRLLNPEAVRTVAAAIQQVADREMDNLLNDQLEDLRR
RYATEVTLDPNTAHPSLLVSADRTRVRDTGRKRRAPEHPARFDFLHFVLGTEGFSRSFYY
EVVVEGQAGWELGVVRESIGRKGFDVSLSPEKGCWTLGSYGGRCQANASPPVVLRSARRL
QKVGVFVHYRDRRVSFFDLRARTLLYSFTKCAFT
Download sequence
Identical sequences H3D0S4
ENSTNIP00000014110 99883.ENSTNIP00000014110 ENSTNIP00000014110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]