SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014157
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 4.67e-80
Family Arrestin/Vps26-like 0.0000000801
Further Details:      
 
Domain Number 2 Region: 178-349,382-406
Classification Level Classification E-value
Superfamily E set domains 7.93e-66
Family Arrestin/Vps26-like 0.0000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014157
Sequence length 411
Comment (Tetraodon nigroviridis)
Sequence
FCSIFSFRVFKKASPNGKLTVYLGKRDFVDRVDQVESVDGVVLIDPEYLKERKVFVTLTC
AFRYGREDLDVLGLTFRKDLFVANSQMFPSPPDLEKSLTRLQERLMKKLGEHAHPFTFKI
PLNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENPEEKIHKRNSVRLVIRKVQYAPEKPG
PQPTAETSRQFLMSDKLLHLEASLDKQIYYHGEPISVNVHVTNNTNKTVKKMKVSVRQLA
DICLFSTAQYKCTVAMEESDDVVPPSSTFCKVFTVTPFLANNRDKRGLALDGKLKHEDTN
LASSTLLGEGASKEILGIIVSYKVKVKLVVSRGGDVSIELPFTLMHPKPLEDVDADDPNP
APGEAQTDRNLIEFDTNNFHLLLLSDDDIIFEDFARQRLTGVVDEKQEEEE
Download sequence
Identical sequences H3D0X1
ENSTNIP00000014157 ENSTNIP00000014157 99883.ENSTNIP00000014157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]