SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014296
Domain Number 1 Region: 440-615
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.59e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 617-716
Classification Level Classification E-value
Superfamily E set domains 8.9e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014296
Sequence length 1106
Comment (Tetraodon nigroviridis)
Sequence
MTTANCPGNEELDFRLIFGEDGQQQPLGPADWPSDDDLEPDDNTSFYILNVGQPQSVVTN
HQPLGLPRHGMQSHSQIISTSPRFQTHRPGSEPPGYETQDSKYGTSPLLSSAPLEAPKAF
ACPSIQITSISPSCQQEMDPNENALSANGPDRDFHGDRPLSRDHLYLPLDHAYRDSSLSP
SPCSSLSSRSWFSDASSCESFSHIYDDVDSELNEAAARFTLGSPLTSPGCASPQASGGVL
EEQPHWQHHHPTIVHQSHTINLSPRQSPCHSPRTSVTDENWLSPRPPSRPSSRPTSPCGK
RRHSSADLCYAGSLSPHHSPTATPGPSPRSSVTEDTWVGSPTVGMSPFSCCPSEADIPLK
TRKTSQDRTTMQTVKGELGLDEQGNMSPNLDSPSDEAMHSLKKDGPGEQFLSVPSHFSWN
KPKPGHTPIFRTSSLPPLDWPLPSQFGQFELKIEVQPKAHHRAHYETEGSRGAVKASSGG
HPIVKLIGYNEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEILVSCTKVLE
IPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVLSL
QAASIPVECSQRSAQELPQVDKSSLTSCLVSGGEEMVISGSNFFPESKVIFLEKGPDGRP
QWEVEAKIIREKSQGSCIVVEVPPYHSKTVASAVQVQFYVCNGKRKRSQSQRFTYLSVTV
RQEHRDELDLPPVPPISMPLAHASSLVCTQLPSPEQGHPSDTFCSGPGLLPLQPPCPPLG
SPSFQHLPHLQGHSLQHHPADCHMPFHPNSVPAPARPSYQPMQHSHSHNLPFNGQPSLPS
QGYERMPFQHSPSSGPHPMAMGMVYSSSPCSSPSAPSTPGSNPIVGSPQSQQNLLNPSSP
HLHALGGYHCSPNPTPVPSPPGHPLVVQHSSQLQRAMGYHPIGQRSASCPTPSSAPPPPP
PPRMVPSPHSGPSSPQLHSLPYQSPTSSSPTPGQQQHSGQPSPQATSPVMAGLSPATAAG
PLVHPLSPQGPFPTDGERLNIKQEPEEREPTFRSIGLQDITLDDVNEIIGRDMSQFSPTL
SLSSSLSPSAPCPLPELGFIGRFSGS
Download sequence
Identical sequences H3D1B0
ENSTNIP00000014295 99883.ENSTNIP00000014296 ENSTNIP00000014296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]