SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014474
Domain Number 1 Region: 196-472
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.88e-52
Family FCH domain 0.0069
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-19
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 71-107
Classification Level Classification E-value
Superfamily WW domain 0.0000000000401
Family WW domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014474
Sequence length 474
Comment (Tetraodon nigroviridis)
Sequence
MSGSYCRSLYPFSGEQHQQGLSFDAGEIIRVVQALPGGWWEGERDGHRGWFPTSYVQVLE
RTASLSHLPVEDLKDPLPPQWKCYMSPQGRRYYVNTTNNETTWERPSSAPGTPRTSLRHK
NSLPAVLVNGFHSGGSPLHHVEHNNLVRKSSTEPQSPGSTSPTRKQGKETTVTINYVTFP
SLACMTEQQLLKPDEWSYCDFFWNDKRDAQSNSCITGFEVLLQKQLKGKQMQKEMAEFVR
ERIKIEEEYAKNLSKLSQIHLAGQEEGTLGEAWAQLKKSLADEAEVHLKFSSKLQSEVEK
PLLTFRENFKKDMKRFDHHIADLRKQLANRYAAVDKARKALSDRQKELDVKTQQLEIKLS
TKIEEDIKKARRKSTQAGDDLTRCVDLYNQSQSKWFEEIVTTSLELERLEVERVEMIRQH
LCQYTTLRHETDMFNQSTVEPVDHLLQCVDPAKDRELWVKDNKTGEIRPVDLEI
Download sequence
Identical sequences H3D1T6
ENSTNIP00000014474 ENSTNIP00000014474 99883.ENSTNIP00000014474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]