SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014843
Domain Number 1 Region: 196-247
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000523
Family SOCS box-like 0.0055
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000365
Family Ankyrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014843
Sequence length 274
Comment (Tetraodon nigroviridis)
Sequence
MVSPMYVAVSRHQSESVRVLLSEGFSPDAQDCTHTLGLHSPLFLALSHTPDKPYSESVRL
LVAAGAHMKEEDWFYALATDQTALLQLILEYRWISPPETPTGSGSVFQRDGKVSFQLQEL
RELLCVALEHVHFAPCWLPVLLKAGLQPSLLLHPHMFDHADSDALNYLLEFVNWTTLPGG
LKIILERRREEQTWKPWPHFDTITSLSHMCRLQIRSMLGPDLLMRTSIVQQLPVPSPLHC
FLQFRDIQEPSYKHSPLSNQIQRHNNTHQHRHVL
Download sequence
Identical sequences H3D2V5
99883.ENSTNIP00000014843 ENSTNIP00000014843 ENSTNIP00000014843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]