SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015072
Domain Number 1 Region: 259-430
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.77e-58
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000079
Further Details:      
 
Domain Number 2 Region: 430-563
Classification Level Classification E-value
Superfamily E set domains 2.61e-33
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015072
Sequence length 1201
Comment (Tetraodon nigroviridis)
Sequence
MPSDFVSLLSSDLDLNSPNSLYCKESVYDLLPKELQLRPSSTQTDPPTMSQTSGGEAGPP
PSAALASALREAAHLCSTSNSSASSSLTMGVPSPIASTAPSDHLMVPQQGHSGGGGGAGA
SENTPSKRRPVLNISPPPEDLFDDSQMSFQEEPAVCAPVGADSEHSSSIWADDSVSNFSL
VSSVSYNDNTEVPRKSRKRTTRQRPGPKPAPEDSMDVFDADSAKAPHFVLSQLGTDKISP
ISSSHESGITVKGGSLSTQFPQRSDGKELKILIQPETQHRARYLTEGSRGSVKDRTQQGF
PTVKLEGVSEPVVLQVFVANDAGRVKPHGFYQACRVTGRNTTACKEVDIDGTTVIEIPLE
PSNDMTLAVDCVGILKLRNADVEARIGVAGSKKKSTRARLAFRVNIPEPDGSVLTLQVLS
SPLLCTQPAGLPEILKKSLHSCSVRGGEEVFIIGKNFLKGTKVIFQENIADDNSWQGEAK
IDMDYFHQNHLIVTVPPFHNQSVTSPVSVGIFVMTNAGRSNEAQTFTYVPDSVDNSESQA
VKTEEPSLLEPCIFDGQPKSISSEQSDCSSQSSKRQEDTPMEVSSNQTPTDIFKAPADPL
VSVQQTLELSSSPHTGAESFQNPLPLQPEDVELPQAPPVFPCLETLSIIQKQDLSPSTAF
PVSGDTTIPPVTPEVPQQFLRDPQESMTPDRSNSGGGVVVVSMPQLAAPPQPQAQQSQMS
LFPEEGVALERAVRELQAGQQLNSVLYSPTPSAESLQQHVQENMNSLRLGTADNSVLGTM
QIQQQLILQPQEVLNNIQLQEQQQQQNQLLNNLQHQNQALSNLQQQQQLQEQVLENLQQQ
LQAELLQPQMHSSSQVQQPVSLLQQAGDLLTIQTSFPTQPPSHTSPPQQLFQSPRSLAES
QVQAALLQNTLTVLASGSLASEPQSAGSALYLSPNPPLAFISAIETSSQPQPVAIFQNQP
QAQLSQMQQQSTPMEQQQSPQQNSQPPQLPMGQQSTLFQGIPNHLQVANPGSQSQLSQPQ
QTGLLLCTTELNPQALLFSTQTPGPSPAGGIGVGIPQPDPAEPMSFQDQSSSHNNPASTE
NQQQNLFQDQQPMQVGPGSGSLPSSQPVELFLPQTSLSGLQNNIDPQEMSSQPAAAGTTI
FVVQGGVGVVASPGQQPSDQLFQTNVGGSVAPQGQANLFVFSIQNDSPQLLNSSGPPLPA
Q
Download sequence
Identical sequences H3D3I4
ENSTNIP00000003494 99883.ENSTNIP00000015072 ENSTNIP00000015072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]