SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015320
Domain Number 1 Region: 7-143
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-45
Family C-type lectin domain 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015320
Sequence length 149
Comment (Tetraodon nigroviridis)
Sequence
PSAALTMSLLTDKKCPTGWKMFRSSCYYISAGKKRWKDSRDYCKTKRADLAIIKTQEEMT
FINSLFGSDKEVWIGLTDEGSEGQWKWVDGSPLTTAFWGDNQPNSYDGRNQDCVEFWHHA
TGNGDWNDEHCNVENNWMCKISPQFSPVL
Download sequence
Identical sequences H3D482
ENSTNIP00000015320 ENSTNIP00000015320 99883.ENSTNIP00000015320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]