SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015669
Domain Number 1 Region: 4-85,122-237,340-444
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.49e-16
Family LacY-like proton/sugar symporter 0.076
Further Details:      
 
Domain Number 2 Region: 257-295
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000513
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015669
Sequence length 470
Comment (Tetraodon nigroviridis)
Sequence
LCAGILFSTLVFGPACGFILGSLCTKFYVDAIFIDTSKLGITPDDPRWIGAWWFGFLLCG
ALLFCSALFMFGFPHSLPTREKEGGGGGQRARYASSSSQPRSLPTAPPAVSSSESNAQLC
ISVPLVIPKVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTTSANQLL
GMTAIPCACLGIFMGGLLVKKLNLSALGAIRMAMLVNLISTACYVSFLFLGCDTGPVAGV
TISYDNRSVSVGRIPEAQCFSHCSCFNSTISPVCGSNGLTYLSACFAGCTSRNSQAPTGR
SGSSITQNLSGCSCVSADSELATALPGKCPMPGCREAFLIFLCVVCVCSLVGAMAQTPSV
IILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAAIDSTCLFWSSDCGSRGACVLYN
NVSYRHLYVSLAITLKGVAFLLYTTTWYLTQELQEASRLQTLLSIETQYI
Download sequence
Identical sequences H3D580
ENSTNIP00000015669 99883.ENSTNIP00000015669 ENSTNIP00000015669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]