SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015811
Domain Number 1 Region: 15-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.5e-54
Family FCH domain 0.0067
Further Details:      
 
Domain Number 2 Region: 338-397
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015811
Sequence length 397
Comment (Tetraodon nigroviridis)
Sequence
MASLPKDPPEDPRKQSFWVPGNYVRTVQRTEQSFQACNDIVACFVERAKVEKQYAQQLSQ
WSNKWKSIVDSRPLYGSLMKAWQCFFTSTERLSSLHSSISDSLGQRRMEIHFKVKVYTSS
SSKINQLMTIKYDQKRAEEMIRTKVRHYLNPGFQLDKVRAAYHKSCQKEQTALDKEKQAN
EDAEMSPEKKEKLAGAREKATGEKLKYKEQYEKVLEDVSAYTPRYMEEMESIFEQSQEEE
RKRISFLKQAFLSIHRHLDVTNNESVKAVYNELHQTLMSISEQEDLKWWKNNHGPGMPTD
WPKVEDWVPPVKKLNRKKRQKRMESRPCLVSTLSRVMIGGVKVRALYDYIGEEGDELSFK
AGEVFLKVEEEDDQGWCRGVLSGGKEGFYPANYVEVV
Download sequence
Identical sequences H3D5M2
ENSTNIP00000015811 99883.ENSTNIP00000015811 ENSTNIP00000015811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]