SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015903
Domain Number 1 Region: 217-307
Classification Level Classification E-value
Superfamily PX domain 3.53e-25
Family PX domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015903
Sequence length 374
Comment (Tetraodon nigroviridis)
Sequence
VSMDPSPQPTTAASGPPPPALPEAMTVAELRQATVAMMNRKDELEEQNASLRNLLDGEME
HSAGLRQETDLLKKKLAELEERHTARIQALSRENEVLKVQLKKYVGAVQMLKREGSQVAK
LPFLWRCDDALVPPNKSMGDIEELAASYERKLIEVAEMHGELIEFNERLYRSLMAKDHLI
VQMRQELIDLRGPVPGDLSQTSDDPSLSDFETAHRALINVWIPSVFLQGRAANAYHVYQV
YIRIQDNEWNVYRRYTEFRELHNHLRTQFPQIDAFAFPPKKALGNKDAKFVEERRKQLQG
YLRMVMNKLIQTLPEFTARPTKETLLSLLPFCLDTPQTNDSVAKTPRSKTSSRFPRLGRN
RNQEARPEPQSGDL
Download sequence
Identical sequences H3D5W3
99883.ENSTNIP00000015903 ENSTNIP00000015903 ENSTNIP00000015903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]