SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000015932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000015932
Domain Number 1 Region: 150-297
Classification Level Classification E-value
Superfamily EF-hand 1.4e-50
Family Osteonectin 0.000000323
Further Details:      
 
Domain Number 2 Region: 92-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000194
Family Ovomucoid domain III-like 0.00019
Further Details:      
 
Domain Number 3 Region: 67-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000653
Family Follistatin (FS) module N-terminal domain, FS-N 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000015932
Sequence length 299
Comment (Tetraodon nigroviridis)
Sequence
MRVWILFVLCLAASARAAPAEEEAFVEELVTEEPVVEEPEVGANPVQIEVGEFDEAIEIV
EDDAVENACLNHHCKKGKVCEVDESNTPMCVCQDPTTCPPAEAEFEHVCGTDNKTYDSSC
HFFATKCAEGTKKGHKLHLDYVGPCKFIEPCVDSELHEFPLRMRDWLKNVLVTLYERDLD
HNLLTEKQKLRVKKIYENEKRLQAGDHSLDLLAHDFKKNYNMYIFPVHWQFGQLDQHPAD
GYLTHSELSPLRAPLIPMEHCTTRFFEECDADSDNYIALEEWAACFGVKEQDIDKELVI
Download sequence
Identical sequences H3D5Z2
99883.ENSTNIP00000015932 ENSTNIP00000015932 ENSTNIP00000015932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]