SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016013
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-24
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 2 Region: 196-300
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.4e-19
Family Platelet-derived growth factor-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016013
Sequence length 305
Comment (Tetraodon nigroviridis)
Sequence
GVQDSQQEKIITVSGEGMVQSPDFPNRYPRSIEMVWRLVATANMRIQLTFDKRFGLEDPE
DGICKYDFVEIEDLSEKTILGRWCGSQLVPPSQTSKGSQIRIRFISDEYLPSDPGFCIHY
SLLPLSVSEPEQPAVLPPALQGIEELSEAVEGLRTVEEVMRYLEPERWQVDMEELYKPSW
HVLGKSFIHSKKARGADLNLLRDEVRLYSCTPRNFSVSLREELKRTDVIFWPSCLLVNRC
GGNCACCSHRCYDCQCVPTRVTKKYHEVLLLKHRNGGKGLQKSLTDVPLEHHEECACVCK
ENGGS
Download sequence
Identical sequences H3D673
99883.ENSTNIP00000016013 ENSTNIP00000016013 ENSTNIP00000016013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]