SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016441
Domain Number 1 Region: 93-128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 35-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000016441
Domain Number - Region: 544-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000103
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number - Region: 488-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000684
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016441
Sequence length 586
Comment (Tetraodon nigroviridis)
Sequence
MRTEVALQLGFCALCVTLTLLGEGMGVELSDPPAVDCVWGPWTPWRSCDPCTRTRRRSRG
VEVFGQFGGSACQGSVGDRESCLTDARCIQPPPPECSDTEFQCESGYCIKKRLLCNGDYD
CEDGSDEDCDPGRKICPPSVLETNEQARTAGYGINILGSDPRMNPFNNDFFNGRCDKVRN
PKTLQYERLPWNVGVLNYQTLVEETTSREIYEDSHSLLREMLKEMSIKVDAGLSFKFKST
EPSMSNVSLNLDASLEYEKKTMIKEISELTNIQNKSFMRVKGRLQLSTYRMRSYQIQVAE
EFLAHAKSLPLGYEKGIYYAFLEDYGTHYTRNGKSGGEYELVYVLNQDSIKARNLTERKI
QECLKIGIEAEFATTSVKDGKAHVNYNKCDDVTTKSQGDVYGKALVDSVLTSVKGGTLES
AVAMRAKLNKEGVMDIGTYQNWARTIADAPALINSEPEPIYMLIPTDLPGANERISNLKQ
ATADYVAEYNVCKCKPCQNGGTLALLDGKCICMCSNLFEGLGCQNFKGDKLRTPVARPAV
TQEGNWSCWSSWSGCQGQKRSRTRHCNIEGVPGAVCRGDTRSEEHC
Download sequence
Identical sequences H3D7F0
ENSTNIP00000016441 99883.ENSTNIP00000016441 ENSTNIP00000016441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]