SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016445 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016445
Domain Number 1 Region: 81-158
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.79e-34
Family Fibrinogen C-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016445
Sequence length 158
Comment (Tetraodon nigroviridis)
Sequence
EALRRGQGSLGQDLNTLQTEQGRLIQLLSDSQINMVKVVNSVSDALNAMQKENVGLKARV
KADLQRAPVRGARLKGCSNGSRPRDCGDLYASGHREDGIYSVFPVHHPAGFQVYCDMTTD
GGGWTVIQRREDGSVNFFRGWESYREGFGKITGEHWLG
Download sequence
Identical sequences H3D7F4
99883.ENSTNIP00000016445 ENSTNIP00000016445 ENSTNIP00000016445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]