SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016475
Domain Number 1 Region: 63-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000236
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016475
Sequence length 320
Comment (Tetraodon nigroviridis)
Sequence
MERTFREQLFVLLLSLSVLKGDCRYIENNEISKDELYSFFNAELKRETPEELMFRRPLRC
LDMIAVEGQFSFAPEHPQLSCAAFLLAEPNQVISVDYDSVDIDCSGGDFITVFDGWVMKG
EKFPSPQDHPLPLYERYVDYCDSGSLRGSVRSSQNVAMVFFRIHNPGSSFTLTVRKHVNP
FPCNVISQSPEGAYTMVIPQQHRNCSFSIIYPVEINVSEFSLGQFNHFPKRSRPVCAETG
DFVQLLGGNGIDTSKLLPITDLCVSFTGPTHLKVGCDNTVVRMVSSGKFVSRVSFSYRLL
DRQELQTIKLNNVEDFCFNN
Download sequence
Identical sequences H3D7I4
ENSTNIP00000016475 ENSTNIP00000016475 99883.ENSTNIP00000016475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]