SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016514 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016514
Domain Number 1 Region: 2282-2467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-32
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 2883-3047
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-32
Family Laminin G-like module 0.0000465
Further Details:      
 
Domain Number 3 Region: 2103-2278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.53e-26
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 2706-2844
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-24
Family Laminin G-like module 0.00074
Further Details:      
 
Domain Number 5 Region: 2473-2661
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-23
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 820-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000121
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 7 Region: 873-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 770-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 9 Region: 251-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 10 Region: 378-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 11 Region: 1377-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1434-1485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 13 Region: 709-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 14 Region: 1015-1063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 15 Region: 308-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 439-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000016514
Domain Number - Region: 1483-1524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00026
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 969-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 922-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 674-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 1333-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 59-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0241
Family APC10-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016514
Sequence length 3065
Comment (Tetraodon nigroviridis)
Sequence
GLFPAILNLASNAVIDSNATCGDPGPEVYCKLVEHVPGRPVKNPHCARCDANSVLFRERH
PITNAIDGTNRWWQSPSIKNGRQFHWVTVTLDLKQVFQVAYVIIKAANSPRPGGNWILER
SLDGLTFDPWQYYAISDSECLSRYNVTPRLGPPTYKKDTEVICTSYYSRLNPLEHGEIHT
SLINGRPGADDLTSELLNFTSARYIRLRLQRIRTLNADLMTLSTRDPRDIDPIVTRRYYY
SIKDISVGGMCICYGHAQSCPLDLVTKKLQCVCEHNTCGESCNECCPGYHQQPWQPGTVS
EGNTCEKCNCHNKATDCFYNQTVAELSLSLDLHGLRRGGGVCVSCQQNTAGVNCESCVDG
YYRPAEVSPYSDFPCVACSCDPRGSESPVCSRGDTQPGQCVCKQGFTGRQCDTCAFGYRD
FPQCVRCECHSAGSTNADPCTPCTCKVNVMGANCDLCKPGFYNLQASNPLGCTDCFCFGV
SDVCESSAWSTAQVLHVDAWLLPHPAPPLTPVVHDNDLHTPGNTSSGHSYQEILLWEAPD
SFLGNKLGSYGGFLNYSLVYDVPLDNQDHSLPAHSDVIITGNGRALHSSPHFLFLSPLAE
SWVAMAIADRQLRDVETGDPVSRDELLLALANVTALTVRVGLNTSADGPIRLRLVSLDSA
DPSSASTQQAVAVETCECPWGYSGTSCEVCLSGFYRVGGVLFGGNCMQCECNDHATECDS
AGVCLLCSSGCAHNTSGPHCEECLPGFYGNATEGTADDCQPCPCPLTNPSNSFSPTCVLE
ASGQVSCDRCQEGYTGTTCERCASGFYGNPQVVGGTCVRCDCHGNVNVSEAGHCDVVTGE
CLRCLFNTGGPHCEVCQPGYYGDAVRAKNCQECGCDVVGAVSSVCDVTTGQCLCRENVTG
RACERCQSGFFGLRREQGCQGCGCNQSGSLSESCDEEGRCRCMTGVGGDKCDRCGHGYYG
ADISSCRACTCVHTGGNCDPQTGECTCPANTEGPTCGRCKAGYWGHNPTTGCEPCSCSVE
GSSALECDLTNGQCQCREGFGGKSCDHCATGYHGYPACLPCGCDLAGTDEKCRQHNARYV
SQRLAVHQCVCFQVGVSGRRCEECVSGRFALSADHPDGCSPCFCSGVSGDCEEQGGLLRV
PLTLDPSPAPLSVVSQSNLRGVVSGVYQQGGDMLLDTRQLNTSGLAGPLYWRLPPQFEGP
QLLSYGGSLSYTITFYAEDGSGLSNQEPQVMIRGGTLKKMVIYTDMVAPSNGITTKHEIR
MTEHKWKYFNSVLETSVSHPDFMSVLGNIEYLIIKASYGSRLQQSRISNITMETAVEAAE
GSEVIGDLARSIESCICPTGYTGLSCQGCAAGFFHQPLSELSSQRQRFLSVRPCVPCRCS
NHSERCDVESGECQDCQHHTSGESCQQCAPGYHGNVSGSISDCSLCACPLKDNSFSATCV
SEGLLGDFRCTACQSGYQGRYCERCSTGFYGNPSVPGGVCLPCDCSGWGSRQPVCNNLSG
KCDCKAGVKGRSCDQCEDRHILQEGECVSCDDSCTGVLLNELEDVDHHLRTVNISSLAVA
SYLQLAQLEKQSRQLQVTAQHRRLLGTQQCSDDALVCVAGAGGRRRCSLSAAEQTGRAAR
VEDSCKPRGLMGPALQKEAELLNETAEEELPSANQTRLLQQMEMMLNSMRELNLTAASSL
ASQQLLRRSSNGLSSSRLAKSVHSLQTDFLSSRAVVDDRLRPLSAALDRNSEMLRHLREH
LSNAAQQNQQTHKLQGGLHTLAQQYQSVQRNLSEEHLLVAGSVEDGQLLLADTFSIQEDL
NNATAQVEVFSSHLDQWRPLLRKQVDGLVVGLKTTDALEKVYQSEKHSQQLQEEGHTLHS
LLSVCNVSLNGSQLRQWTSEVTDQVHRSQQVAFMADASAWEAEKLLTEKVGRMREDSSRV
YENARRTMNVPGGAPGEQLTDEEKEIINGVLARAAMMESREQERIGCLKPDMGKKAAAPA
SSMEKQRTKKEKALVAGDAAASQQLSRLEEQLGSVSFNLSVLEQQVGTFIQLTFVPSRND
KIQANQAQQKLGEVERRTERLMEQIKPLSVLGETLNRNLSEIRELIKQARRQAASIKVAV
QADGKCVRSYRPESESRNFNTLSLVLKTSSPDNLLFFQGSNTTRDFLALETHAGRVSLLW
DLGSGSTRLEFPGLDIANNRWTRINATRFGARASLWVHPLESDAEPLPAVMASSPGPARI
LDVDRNSLLYIGGLGAHVQSPAALRSSTFRGCLGEASLNERNVGLWNYNSREGECGGCFS
SPQAEETSFHFDGSGFSLVQKSLRATSTSIVLLFKTLSPGGLLLYLASNNTRDFLSIELV
EGQVRLTFDLGSGALVLTSSRKYNTGTWYKITLQRTKRKGYLSIMAADQPSEKEVLEAES
PGTASDLNRSDFDPIYIGGLPASRPISLLVRRQVVSRSYVGCIKNVEIARSNFDLLRDAF
GVRKGCVLEAFRSVSLLTGGYVQIAPQPLGQEAELLFSFSTNNQSGILLAAFSPDHSQRR
VGRGVYFLSIHLASGAVEAVIGEVGGAPQTVTVVKTNGGYFSDGVRHSVIVTINRKTLSI
QVDEDNVKSIALLPGRFSHLSPASFFIGGVPFGAESRLPARLQELSLSFRGCIQHLVLGG
VLIDLSGALRYEGAELDSCLLKEKVRGAVLPDDQDAEPTVDPAHLPVVPPTQLTPGPLTC
VSEAAPSFLPSAAQFGLSKHSHMTFMINPSALRKSLSVRLSVRSRVPDGMILLLSDAKQM
DFVVLKLTGGKLTLSADLGRGPASITSPVTVSDSQWHTVSAEVSRRSLSLAADASKPNSV
SIKGNQLDVEKRLYLGGLPHGHATRRINPVADAVLLCLRSAAVFRAACTPSPERRRAGSV
QTTSRHNVTSCFTNDQAGSYFNGKLRRLQVRDGYKVGSDVSVSLDFRTSQSEGVFLGISS
AKIDAIGLEMINGQVVFNVNNGAGRVTVASAGQLLCDGRWHHLLARKTKHSLSLKVDGRS
YTTLNPYPQSTSAETKDPVYLGGYPVGVKQNCLSIASRFRGCLKNAQLAKNSCLNWRIIG
DKNSN
Download sequence
Identical sequences H3D7M3
ENSTNIP00000016514 99883.ENSTNIP00000016514 ENSTNIP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]