SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016530
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.28e-27
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016530
Sequence length 493
Comment (Tetraodon nigroviridis)
Sequence
CNPGGAVDSGVPLLRAVFLRRLRLTRLLLEGGAYINESDGQGQTPLMVACRTQHCDAQSA
SRVKLVQFLLEKGADPNIQDKEGRSALMHACLEQAGAEVVSLLLDSGADISLEDHSGTSA
LVYAVTARELKVLKLLLDRCKAQGKEVIIIATDKLPYERLQAKQYISMPSLSLDPAAPAS
PSEIQLITSPMCPASSVCPPKTLFSFKEDPSRGRSSHPCSPSHFQRLGQAAPLQQPLLRL
NSEPWLKIPETLLAKQLQTASEDDEDLVQLPLGVPNLDESSCRCEDRPVKRLEGKETEDG
VKQTMALPLSTHSASHPNLHSANMGTDSSSSLPGNKHLSSPVHGAASSSLHSIIQRRKVG
ADIYSSDPQLALDVQNVPHDSQRAKDPADGKRLPPLRCCSTLGSGESRRRLPGFERRGSG
AYLLEHSSQARPRTLPPLTFIPSNTPVLASLCAKEQGPKHAFPSAPPGHPKEPTRRMLLR
RHSIQTEQFKSTA
Download sequence
Identical sequences H3D7N9
ENSTNIP00000016530 99883.ENSTNIP00000016530 ENSTNIP00000016530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]