SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016583 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016583
Domain Number 1 Region: 351-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 167-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-16
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 3 Region: 469-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 528-590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 595-655
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000747
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 113-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000283
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 1-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000144
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number 8 Region: 290-354
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016583
Sequence length 750
Comment (Tetraodon nigroviridis)
Sequence
CMVNFSDPEGYIDSSDDPPLSDGSSLHCTYTVTVYTGYGVELQVKSVNLSEGELLSIRGA
DEQGALMVLANHTLLVEGQVIRSPTNTLSVYYRSTPEGNMGIFQLHYQIFRLSCSLPKRP
HFGEVSVLDLLPGGVARFHCHMGYHLQGESQLTCLNASLPVWSSKLPTCRALCGGTVKNA
TVGRVLSPSPHHGPNATQDRSCSWSLEAPKDQRLHLHLERLVLGPTDSRLVLWSGLDAGS
IVLFDSGHGGQIPFEGVISEGPAVRIQFITDQPNHNTGFNIRYEAFERGHCYEPYLQNGN
FTTTDPLYGVGAVVQFSCNPGHALEQGPPVIECISARDPYWNDTEPLCKAQCGGDLSGPG
GVILSPNWPEWYGEGEDCSWKIHVDEDKRVLLDVQLLNISDSDMVTITDGEELATRILGR
YVGGSSPFKLFSTTPDLTVTFHSDPAGLVFGKGEGFIINYMEVSRNDSCPDLPEIQNGWK
TTSHIALVRGARITYQCDPGYDLVGQDTLTCQLDLSWSSLPPFCEKIMYCSDPGHVEHST
RSLSDPKLLVGTVIQYSCNPGFVLQGGATITCYGREPGTPVWTSGLPHCVSEDSVSCENP
GLPDNGYQILSKRLYLPGESLTFVCYQGYELIGEAAIKCILGNPSFWSGPLPLCRANPEC
FDNHALEVAEATAGSTLDGGTIALAVFILVLLLSVLLGGAYVYVTRCRYHSNLRLPLIYP
HPYRQITVETEFDNPLYETAGETREYEVSI
Download sequence
Identical sequences H3D7U2
ENSTNIP00000016583 99883.ENSTNIP00000016583 ENSTNIP00000016583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]