SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016674 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016674
Domain Number 1 Region: 2-330
Classification Level Classification E-value
Superfamily L domain-like 4e-64
Family Ngr ectodomain-like 0.073
Further Details:      
 
Domain Number 2 Region: 829-922
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-27
Family PDZ domain 0.0045
Further Details:      
 
Domain Number 3 Region: 683-785
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-26
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 4 Region: 537-651
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-24
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 923-1022
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-24
Family PDZ domain 0.0000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016674
Sequence length 1174
Comment (Tetraodon nigroviridis)
Sequence
PFFRLLNLRKLSLSDNEIQRLPPDVANFMQLVELDISRNDIPEIPESIKFCRALEIADFS
GNPLSRLPDGFTQLRALAHLALNDVSLQTLPNDIGNLANLVTLELRENLLKSLPTSLSFL
VKLEQLDLGSNELEVLPDTLGALPNLRELWLDRNQLSSLPAELGNLRRLVCLDVSENRLE
ELPSELNGLLALTDLLLTQNLLEFVPDSIGCLKQLSILKVDQNRLTHLTDSIGECENLTE
LVLTENLLQSLPHSLGKLKKLTNLNVDRNRLSSVPKELGGCSSLNVLSLRDNRLGRLPAE
LADATELHVLDVAGNRLQNLPFSLTNLNLKAMWLAENQSQPMLKFQTEDDERTGEKVLTC
YLLPQQPSPSLENLLQSSVDDSWTDSNLNRVSVIQFQEETKAEEEDDEAAAERRGLQRRA
TPHPSELKVMKKVIEERRNEAYTSRSDGADENEDQQPTVHFAEEPIIRGGDEDEEEDGED
GDRSDEEDERPPFPMEKQRLIRKDTPHYKKHFKITKLPKPETVAALLQGFSPDGLNSPTG
GVSFDQVNNLLIEPARIEEEEHTIIIQRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSA
EGPAARAGVKVGDKLLEVNGVDLHEAEHHTAVEALRSSGATVSMTVLREHMVEPENAITT
TPLRPEDDYFPRERRSSGLAFNLEPTTSGPQQRFTTCLIRNDKGLGFSIAGGKGSTPYRT
GDMGIYISRIAEGGAAHRDSVLRVGDRVISINGVDMTEARHDQAVALLTGTSPTISLVVE
RDPKASMGSPGQSRARAHSPPPPEPSDSPDQEEEGLQGNHLGQMEDEYPIEEVMLVKSGG
PLGLSIVGGSDHASHPFGVNEPGVFISKVIPHGLASQSGLRVGDRILEVNSIDLRQATHQ
EAVRALLANKQEIHMLVRRDPSPPGMQEVVIQKQPGEKLGISIRGGAKGHAGNPFDSTDE
GVFISKVSSIGAAARDGRLQVGMRILEVNNHSLLGMTHTEAVRVLRAVGDSLSMLVCDGF
DPQKVTSVEASPGIIANPFAAGIVRKNSMESISSIDRDLSPEEMDIMQKNISTGPLKLDY
KTLAALPTASLQKINRTRPGAIHPVGRVRQGTSPATPDGHSPNPFQHGPSPFNSQTSPCA
PSPTSPDEFPMNVKQAYKAFAAVPRSLAVLEPPQ
Download sequence
Identical sequences H3D833
ENSTNIP00000016674 ENSTNIP00000016674 99883.ENSTNIP00000016674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]