SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016917
Domain Number 1 Region: 361-548
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.09e-80
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000373
Further Details:      
 
Domain Number 2 Region: 28-121
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.49e-44
Family A heparin-binding domain 0.0000024
Further Details:      
 
Domain Number 3 Region: 122-186
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 3.66e-30
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000175
Further Details:      
 
Domain Number 4 Region: 291-348
Classification Level Classification E-value
Superfamily BPTI-like 9.51e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016917
Sequence length 756
Comment (Tetraodon nigroviridis)
Sequence
PHIYLGRFLIKPSLSLQVPADDTVGLLTEPQVAMFCGKLNMHINVQNGKWESDPSGTKSC
IGTKEGILQYCQEVYPELQITNVVEANQPISIQNWCKKGRKQCRSHTHIVVPYRCLVGEF
VSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGERSMNLHDYGMLLPCGIDRFRGV
EFVCCPAETERETDTSEIEGGESDVWWGGAEPEYSDSSMPRTADAGPANTPENEDVAEDA
FERDETGDDEDEEDDDDDDVDVTDEQESDERGASVAMTTTTTTTTESVEEVVRAVCWAPA
ESGPCHAMLERWYFSPEKRRCVPFLFGGCGGNRNNFESEEYCLAVCSSSLPTVAPSPPDA
VDQYLEAPGDDNEHADFKKAKESLEAKHRDRMSQVMREWEEAEHQAKNLPRADKKAVIQH
FQEKVEALEQEAAGERQQLVETHMARVEALLNSRRRLALENYLGALQASPPRARQVLSLL
KKYVRAEQKDRQHTLKHYEHVRTVDPKKAAQIRPQVLTHLRVIDERMNQSLALLYKVPSV
ASEIQNQVYVIVQKVQSELSQQVSSLQSEGQLDGLVSYGNDALMPDQAYSSAPMDTGLDG
LGFVHPESFNQANTENHVEPVDARPVPDRGLPTRPGKGAGVTRFSALKPEEMPQVRMETD
ERQSAGYEVYHEKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLRKKQYTSIHHG
VIEVDAAVTPEERHLARMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences H3D8S6
99883.ENSTNIP00000016917 ENSTNIP00000016917 ENSTNIP00000016917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]