SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000016966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000016966
Domain Number 1 Region: 348-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-26
Family MAM domain 0.0037
Further Details:      
 
Domain Number 2 Region: 22-156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000816
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 121-234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000115
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000016966
Sequence length 499
Comment (Tetraodon nigroviridis)
Sequence
RHYRQVLTGNPVGVCRYGRRLECCYGWMKNSKGQCEAQCAHGCKHGECVGPNKCKCFPGY
TGKTCNQDLNECGLKPRPCEHRCMNSYGSYKCYCLNGYTLTADGSCTNSRTCSLAHCQYG
CEEVQGEIRCLCPSPGLQLGQDEKTCVDIDECVTGKNLCPYNRQCVNTFGSYFCKCQEGY
DLKYVDGKYDCVDHDECGAGTHKCSHHADCLNTQGSYRCRCKPGFRGNGFECSAIPDFQV
KPEVLKAKPDEDSKNFIPKSIVTAQPEIPQRHFNYETEVYGGSQSRANSKDEFPREEEEE
EEVHNQLNPRGDVFNINKVDTLGLCLVQPQMLKKSKSHLFTKSLEFFIDCNFDQGACEWV
QDKADSVDWTVMYHDDGNGGAQYYMALSGLVGEPGDTAKMKLLLSDRAQQSSVCLTFDYR
MLGQNVGTLKVLLDNNSYPVWEQSQSRHQSWQTEFLTVAWIEEAPQAIVFEARRGNSITG
EIGLDNVVLTSGPCQDDGD
Download sequence
Identical sequences H3D8X5
ENSTNIP00000016966 99883.ENSTNIP00000016966 ENSTNIP00000016966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]