SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017163
Domain Number 1 Region: 294-372
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-23
Family Intermediate filament protein, coiled coil region 0.00075
Further Details:      
 
Domain Number 2 Region: 65-99
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000022
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000017163
Domain Number - Region: 175-293
Classification Level Classification E-value
Superfamily Prefoldin 0.000471
Family Prefoldin 0.018
Further Details:      
 
Domain Number - Region: 111-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00136
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017163
Sequence length 418
Comment (Tetraodon nigroviridis)
Sequence
MNTVYRSGSSALSLSSLPTSGSSRRVMSVSGTRSVRMSSSSLGSGFDLSGFGAGGGDSGV
VLSGREKVTMQNLNDRLASYLEKVRSLESANAHLEQQIRDWYQKQTPVVRDYSKYEALIN
QLRVKINAATEDNARLMLQIDNARLAAEDFRVKFETEMAARLSVEGDIAGLRKVLDELTL
TRSELEIQVEGLKEELVYLKKNHAEELAALRNQVSASSVNVEVDAKPQADMASVMADMRD
QYESITEKNRRDMESWYKAKFDELNKQMASSTESLQSSRTEINELKRTLQALKIELQSQH
SLKAALDEQLGETESSYSLQLNQLQAIINNLEKELSDMRTDIERQARDYQLLLDVKTRLE
LEIAEYRRLLDGEDLKKVVTKTQPPPVVKTQRKTVVIEEIVNGKVVSRTEDLEHQIIK
Download sequence
Identical sequences H3D9H2
ENSTNIP00000017163 99883.ENSTNIP00000017163 ENSTNIP00000017163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]