SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000017377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000017377
Domain Number 1 Region: 948-1237
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.71e-83
Family Complement components 0.0000191
Further Details:      
 
Domain Number 2 Region: 776-896
Classification Level Classification E-value
Superfamily E set domains 1.82e-34
Family SVA-like 0.0097
Further Details:      
 
Domain Number 3 Region: 1317-1433
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-27
Family Alpha-macroglobulin receptor domain 0.00025
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000017377
Domain Number - Region: 349-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0141
Family Invasin/intimin cell-adhesion fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000017377
Sequence length 1450
Comment (Tetraodon nigroviridis)
Sequence
MWTWSLCVLLSWTLFDHVAADPQYMLAVPAILEAGEESKFCISFLEPNETMTVTVSLKSK
DFNTTLMQMVSKQDFHECRSFEAPSVEKDHVMELEVEVQADTFYSKGARKVLIRQFNPES
FIQTDKPLYLPGQTVQFRVVSLDSKLRPSALKYSVIELKDPSGNRIGQWLNQTTENAILQ
LSHQLNSEAPEGSYEIRTEADGKQALHWFKVEKYVLPKFEVTITSKPEVNIAQEEFEAEV
CAKYTYGQPVAGSATMNVCRGLQRYYFYNPLSVANSPQAELEEPCHKQTKKTDQKGCATF
TFMMSTFTQLDVKALDDQLTMTAHVEEEGTDVKLGNQMTRVISYRLGGLSFINTPTVFKA
GSTVEGTIKAVHHNGTPVANTAVYLFEGEIWSARRLQNLTTDGDGLATFSVSTAARTGDL
KLQASVTPELQYIPYRVPYYENGQHQVSLFQKLSPSGPVISSLEVKAKAGQLPCKQQETF
TITYTVVGEEAGAVDLMYLVLSRGNILRQGSEQFTIEKKLAVNVGEFTFTMMVTTDMAPS
FQVVAYAVLPSQSVIADYADFSTEKCFGHSVSLEFSEGSAVPGEEITMQLDAQPKALCGM
SAVDRSIFVKEPEARLSADTIFRLMPSRRHVPYETEDPQECVPVRLRRSILPFPDGKDPF
TVFQHNGLKMVTNLVIRTPTCLSFKGKHYYSGVGRQYASAPMAGIGFTPQLAYDSAPEIV
SVRTFFPETWLFDLLETGESGQVVKSLKVPDTITTWEADAFCLSSEGFGMAPRVDLTVFQ
PFFLELTLPYSIIRGEQFELKATVFSYLSKCIMLTVTGEESADYKLVPLSGDQYSSCLCG
GERKTVSWNLVASTTGVVEVSVTAAAVASEVSCNNEIVTVPMRGRVDKVTRTLIVKAEGT
EVMEAFNWLFCPKGEELKEESTITLPTNVIMGSARGSVSVLGDIMGRALKNLDGLLRMPY
GCGEQNMALLAPNIYILQYLEKTEQLTPPVKEKALRFLRSGYERQLNYRHYSGAYSTFGA
GVGNIWLTTFVMRSFAKAAEFIYIDQDKMAVTKQWVEGKQQDNGCFEMVGTLFNNRMKGG
VSDEITLTAYITASLLEMNSTVDETVKKSLSCLKTSIEKDGFPNVYTTALMAYAFTLAGD
TETRTRLLNQLNMEAKTKVGGFLYWEQTGENSASLSVEISSYMVLTALSADPSTEDLGYA
SRIVRWLTTQQNYFGGFYSTQDTVVALQALALYSTLVFSPDGSTRVTVASPSASNSFLVT
QDTKLLYQEKELADVEGKHVLEASGTGCAAVQLSVFYNIPAPPEVKTLTLEVSESANCAS
MAARATMNLEIKTGYTGQDNSSNMVILDIKFLSGFAMSRDALERLRGPNNYRVEDKTDRA
LVYIPEIEKDEVITHEVVLIQEHPIIGQKPAVVKLYDYYEPSTKAEKEYTYPCVSGNNRL
KSEHAHGTVK
Download sequence
Identical sequences H3DA36
ENSTNIP00000017377 99883.ENSTNIP00000017377 ENSTNIP00000017377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]